20% OFF shipping at stclaircommercialrealty.com on orders over $79 + up to 10% OFF products
stclaircommercialrealty.com
home > Recombinant Human Fibroblast Growth Factor - acidic (rHuaFGF ) - PR1030 > Recombinant Human Fibroblast Growth Factor - acidic (rHuaFGF ) - PR1030
download picture
Recombinant Human Fibroblast Growth Factor - acidic (rHuaFGF ) - PR1030Recombinant Human Fibroblast Growth Factor acidic (rHuaFGF) Catalogue Numbers: PR1030 10, PR1030 50, PR1030 1000 Sizes: 10g, 50g, 1. 0mg (contact us for the 1. 0mg option) Source: Escherichia coli Molecular Weight: Approximately 15. 8 kDa, a single non glycosylated polypeptide chain containing 140 amino acids. Purity: >95% by SDS PAGE and HPLC analyses. Biological Activity: Fully biologically active when compared to standard. The ED50, calculated by
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

Recombinant Human Fibroblast Growth Factor- acidic (rHuaFGF)

Catalogue Numbers: PR1030-10, PR1030-50, PR1030-1000

Sizes: 10µg, 50µg, 1.0mg (contact us for the 1.0mg option)

Source: Escherichia coli

Molecular Weight: Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 140 amino acids.

Purity: >95% by SDS-PAGE and HPLC analyses.

Biological Activity: Fully biologically active when compared to standard. The ED50, calculated by the dose-dependant proliferation of BAF3 cells expressing FGF receptors (measured by 3H-thymidine uptake) is less than 10 ng/ml, corresponding to a specific activity of ≥ 1×105 units/mg.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.

AA Sequence: MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D

Endotoxin: Less than 1EU/mg of rHu aFGF as determined by LAL method.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

Description: FGF acidic, also known as FGF-1 and endothelial cell growth factor, is a member of the FGF family of mitogenic peptides which currently is comprised of at least seven proteins which show 35-55% amino acid sequence conservation. FGF acidic and basic, unlike the other members of the family, lack signal peptides and are apparently secreted by mechanisms other than the classical protein secretion pathway. FGF acidic has been detected in large amounts in the brain. Other cells known to express FGF acidic include hepatocytes, vascular smooth muscle cells, CNS neurons, skeletal muscle cells, fibroblasts, keratinocytes, endothelial cells, intestinal columnar epithelium cells and pituitary basophils and acidophils. As with other FGF’s, FGF acidic exhibits considerable species crossreactivity. FGF acidic and FGF basic stimulate the proliferation of all cells of mesodermal origin, and many cells of neuroectodermal, ectodermal and endodermal origin.

Recombinant Human Fibroblast Growth Factor - acidic (rHuaFGF ) - PR1030

Item no : 26863874774
sold recently : Login >>
US$ 130.12
Pay in 4 interest-free payments of $32.53 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 1 - Jul 6

Enjoy 20% off shipping

US$ 130.12

1-11

US$ 117.11

12-35

US$ 91.08

36-59

US$ 78.07

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches